In diesem Blog kleide ich meine Gedanken in Worte und du musst sie wieder aus den Kleidern wickeln, damit sie pur und bloß in dir wurzeln können.


Das nunmehr über 10 Jahre alte Plejaden Forum wird nur noch selten benutzt. Es hat immer noch über 500 Besucher pro Monat. Der nebenstehende Button bringt dich dorthin.



Mein strahlendes Licht

Ich weiß, dass Geduld nicht zu deinen Stärken gehört. Deine Ungeduld mag aber noch so stark sein, ein Baum wird trotzdem nicht in voller Größe aus dem Boden springen. Er braucht seine Zeit um aus einem winzigen Samenkorn zu wachsen. Das gilt für alles und jedes in der Schöpfung, wie du sie kennst.

 

Doch alles wächst in seiner eigenen Geschwindigkeit. Sie ist abhängig von den Begrenzungen, die in jedem Geschöpf wirken und durch die individuellen Glaubens- und Wertesystemen gebildet werden. 

Dieses "Schöpfungsgesetz" muss anerkannt werden, denn es dient zu deinem eigenen Schutz. Du hast nämlich die Kraft alles in Grund und Boden zu erschaffen und dich damit in Situationen zu bringen, die du und ich lieber nicht erleben wollen. Die Zeit ist in dieser Hinsicht ein sehr weiser Lehrer.

 

Die heutige Zeit fordert jeden von auf, an dem großen Leuchtturm mit zu bauen, der das große Licht tragen kann. Kein Mensch kann das allein. 

Dieser Leuchtturm wird mit Achtsamkeit und Liebe gebaut- das ist der Zement, der alles in dem großen Plan zusammenhält. Die Liebe ist in allen Geschöpfen vorhanden, doch sie muss wieder zum Leuchten gebracht werden. Sie muss in jedem einzelnen Menschen aufleuchten. Dann wird sie über alle Begrenzungen hinauswachsen und ein ganz neues, nie zuvor erlebtes Leben hervorbringen. Doch auch hier wirkt das "Schöpfungsgesetz der Zeit". Damit die behindernden Grenzen aufgelöst werden können und jedes Wesen sich in seinem individuellen Lebenskreis öffnen kann, muss es  in seiner eigenen Geschwindigkeit an sich selbst arbeiten. 

 

Diese Aufgabe hat jeder Mensch mit sich auf die Welt gebracht. Es ist seine Lebensaufgabe, sich zu entwickeln, sich die "Welt Untertan zu machen" und dann weiter in die transzendenten Welten des Geistes voranzuschreiten. Dabei ist zu beachten, dass die bestehenden physischen Systeme nicht unter der aufbrechenden Kraft der Liebe zerbrechen. Du musst in der Lage sein die Liebe in ihrer vollen Kraft in dir aufzunehmen und in ihrer neuen "Frequenz" zu schwingen. Ihre nie zuvor dagewesenen Farben zu tragen und der Docht und das Wachs zu sein, auf dem sich der klare Geist niederlassen kann. 

 

Als individualisierter Mensch bist du jedoch nicht allwissend und musst auf die Entwicklung vertrauen, die das "größeres System" für dich vorbereitet. Du kannst eine einmal erreichte Erkenntnis niemals wieder verlieren und einmal eingegangene "Seelenverbindungen" lösen sich nie wieder auf. Deshalb vertraue in die Intelligenz des größeren Systems, das du auch bist, und löse deine Ängste auf. Die alten Systeme werden um ihre Existenz kämpfen und versuchen dich zu erschrecken, doch du bist durchströmt und gesegnet mit der Liebe der einen schöpferischen Quelle. Dieses Licht ist schon immer in dir und strahlt aus dir heraus, so kann die Dunkelheit, in die, die alten System hinein rutschen, dir nichts anhaben.  

 

alles liebe

Joan

Das Ungeborene in dir

Das Ungeborene und Unsagbare zu akzeptieren ist der erste und schwerste Schritt, den du zu machen hast. Das ist nicht einfach. Deshalb sei liebevoll zu dir aber auch konsequent. Versuche nicht das Ungeborene durch Jonglieren mit dem Verstand in etwas umzuformen. Versuche nicht es zu verstehen. Versuche zu verstehen, dass das Ungeborene auf ewig ungeboren sein wird. Selbst dann, wenn du zu einem tieferen Verständnis seiner Natur kommen solltest. Du lebst einfach, wie du bist - in diesem Ungeborenen. Du bist weder verblendet noch unwissend. In dem Moment, wo du dieses noch nicht Geborene zu »etwas« machst, verwandelst du dich in einen verblendeten und unwissenden Menschen. Du benutzt dann deine Kräfte, um zu erschaffen und das lässt dich in die verblendete Existenz der Unwissenheit fallen.

 

Um deine wahre Natur zu erkennen, brauchst du nur den festen Willen eine Begegnung mit dem Ungeborenen in dir zu erfahren, dich ganz in seine Hand zu geben und hinter dein Bewusstsein zu kommen. Das ist alles. Doch je mehr du dich dabei - aus welchen Gründen auch immer - von der Liebe entfernst, desto unmöglicher wird es für dich werden. Die Liebe ist der Anfang und das Ende und sie gilt für dich und alle Geschöpfe als verbindlich. Es wird dir kein Leid widerfahren, wenn du vom Pfad der Liebe abweichst, aber es wird dir umso schwerer zu leben, je weiter du dich von ihr entfernst.

 

Glaube nicht, dass du »Erleuchtung« erfahren kannst, wenn dein Leben nicht auf das Wohl aller Menschen ausgerichtet ist. »Alle Menschen« bedeutet, es sind die, die du in deinem Leben erfährst. Du bist jetzt ein Teil eines das Universum umfassenden Systems und damit endlich - so wie dein Leben. Also gibt es auch keinen Grund für Allmachtsphantasien oder Großtaten. Deine Familie, deine Kinder, deine Freunde, Kollegen, dein Hund und deine Katze oder auch die Bedienung beim Bäcker, die Kassiererin im Supermarkt, der Busfahrer und das fahrende Verkehrshindernis vor dir auf der Straße sind deine Garantien für dein eigenes Erwachen.

Fühle die Vernetzung der Liebe in deinem Herzen und du wirst ein großes Stück näher zu dir selbst gekommen sein.

 

alles liebe

Joan 

Master Reset Prozess

Der  Master Reset Prozess  ist das Ergebnis meiner intensiven Coaching- Arbeit mit vielen Menschen, die sich für einen eigenen Entwicklungsprozess entschieden haben. Es ist ein radikaler  Entwicklungsweg, der alles in Frage stellt, was du zu wissen glaubst. Er wird die  Grundannahmen deines Weltbildes, die Fundamente deines Selbstverständnisses und damit deiner Realität so erschüttern, so dass du sie von Grund auf neu aufbauen musst. Doch diesmal baust du sie ganz bewusst auf und wiederholst nicht das, was du von den Generationen vor dir vorgeplappert bekommen hast. Der Master Reset Prozess räumt mit den falschen Begründungen deiner Selbstüberzeugung auf und entlarvt sie als weitgehend falsch. Dabei ist der Master Reset Prozess jedoch keine neue Religion oder Philosophie. Er ist nur eine moderne Version uralten traditionellen Wissens, das mit den Erkenntnissen der westlichen Physik und Neurologie abgeglichen wurde. Der Master Reset Prozess ist einfach. Er kann von jedem Menschen durchgeführt werden, der bereit ist seine angelernten Strukturen zu hinterfragen. Der Master Reset Prozess bietet ein neues Selbstverständnis an, das sich aus der konsequenten Anwendung  seiner Übungen ergibt und mit den Erkenntnissen der Quantenphysik, Neurobiologie und Informatik übereinstimmt.

 

Hier bei Amazon bestellen

 

Der Master Reset Prozess ist ein praktischer Übungsweg, mit dem du aus deinen Begrenzungen herauskommen kannst. Es ist eine Methode, die dir zeigt warum du so denkst, wie du denkst und welche Folgen das für dich hat. Für den Master Reset Prozess brauchst du Motivation, etwas Mut und Durchhaltevermögen. Vor allem zu Anfang wirst du dich mit deinen eigenen Ausreden konfrontieren müssen. Das ist nicht immer leicht. Deshalb geht der Master Reset Prozess über die übliche Meditation hinaus und fordert dich auf, gleich von Anfang an zu akzeptieren, dass du ein erwachtes Wesen bist. Es macht keinen Sinn einen „Weg“ oder eine „Entwicklung“ anzunehmen, denn "Erwachen" ist immer im hier und jetzt. Es gibt keine Zeit und keinen Raum, die dabei durchlebt werden müssen. Dein Kopf ist voll mit Suggestionen, die dir etwas anderes erzählen. Deshalb ist es schwierig aufzuwachen und die Wirklichkeit zu erkennen. Diese suggerierten Fehl-Informationen sind in den physischen Neuronal-Netzen deines Gehirns  im wahrsten Sinne des Wortes manifestiert. Der Master Reset Prozess  erlaubt dir, diese Vernetzungen  wieder aufzulösen und neue aufzubauen, die anderen Informationsstrukturen folgen. Das führt zu Änderungen in deinem Alltag. Möglicherweise zu einer völlig neuen Ausrichtung deines Lebens, deiner Ziele und Werte.  Der  Master  Reset Prozess ist eine Werkzeugsammlung, die dir erlaubt, die in deinem Bewusstsein eingeprägten sabotierenden Glaubenssätze aufzuspüren und aufzulösen. Du erhältst im Master Reset Prozess die Informationen, die deinem Verstand erlauben, sich auf die neuen Informationen einzulassen und sie zu akzeptieren. Dann ist dein Verstand kein Gegner mehr, den du überwinden musst, sondern dein Freund und Vertrauter.  Du lernst die Signale kennen, an denen du ablesen kannst, wann ein Sabotageprogramm  in dir aktiv wird und du lernst  damit umzugehen. Die Werkzeugsammlung ist jedoch nur ein erster Teil deines Weges. In der konsequenten Anwendung der Werkzeuge wirst du deine Antworten auf der Suche nach dir selbst finden. Nur du selbst kannst erfahren wer du wirklich bist. Niemand sonst kann dich das lehren oder für dich tun.

Mit der Master Reset Prozess Transformationsformel manövrierst du durch dein Bewusstsein und befreist es vom Müll der Jahrtausende.  Der Master Reset Prozess ist eine stille, meditative Methode, bei der du dich viel mit dir und deinen Gefühlen beschäftigst. Du wirst dabei lernen, wie die Energien deiner Gefühle, Gedanken erzeugen und damit dein Verhalten beeinflussen. Aber auch, dass es viele Saboteure in dir gibt, die auch dein Verhalten steuern.  Mit den Übungen im Master Reset Prozess kannst du  diese ungewollte Steuerung abstellen. Du lernst Achtsamkeit dir selbst und allem anderen gegenüber und entwickelst dadurch immer weniger Angst im Leben.  In dir wächst ein immer größeres Vertrauen in die Tatsache, dass du mehr bist, als alles, was du bisher geglaubt hast. Du wirst entdecken, dass du ein viel größeres System darstellst, als du es je für möglich gehalten hast.

 

Ist Master Reset Prozess einmal mit deinem Denken verknüpft, wirkt er sich wie ein Virus aus und erlaubt dir,  die Illusionen deines Hologramms zu durchschauen. Dabei  webt er sich in deinen Realitätsglauben ein und verändert dein Leben so schnell, wie du es zulassen kannst. Du wirst dadurch in eine neue Spiritualität finden und darin aufwachen. Der  Master Reset Prozess führt dich in die Erkenntnis deiner wahren Natur. Du wirst dich selbst in den vielfältigen Formen der Schöpfung erkennen und in einem veränderten Seins-Zustand auferstehen. Du wirst dich in den Spiegelungen der Welt erkennen und so zum leuchtenden Ausdruck deiner größeren Existenz.

 

Wenn du mehr wissen willst, dann lies das Buch oder schau dir den Blog oder andere Artikel dieser Website an und entscheide dich dann.

alles liebe

Joan

Erfüllung - mach deine Wünsche wahr

Erfüllung ist die Quintessenz meiner langjährigen Erfahrung als Hypnotherapeut und Coach. In den vergangenen 35 Jahren haben sich das physikalisch-wissenschaftliche Weltbild und auch die Wege für die seelisch-geistige Befreiung des Menschen dramatisch verändert.

Ich vermittle in dem Buch die Grundlagen und Übungen mit denen eine Rückkehr aus dem Hologramm möglich wird, das wir um uns geschaffen haben.

Ich beschreibe einen erprobten, spirituellen Weg für inneres Wachstum, der  alle heutigen wissenschaftlichen Aspekte einschließt und doch auch weit darüber hinausgeht.

Dieses Buch beschreibt die Grundlage, auf der ich seit Jahrzehnten arbeite. Es ist für jeden Menschen eine Möglichkeit seine Sicht auf das, was er über diese Welt gelernt hat zu erweitern. Als Arbeitsbuch ist es für jene gedacht, die sich ernsthaft mit der Idee einer spirituellen Rückkehr zu ihrem Wesenskern beschäftigen.

Um Erfüllung in deinem Leben zu erfahren, wirst du sehr gewieft sein müssen dein Leben in Ordnung zu bringen. Du wirst Antworten auf noch ungestellte Fragen brauchen. Ohne diese Antworten, bist du in dieser Welt verloren. Du hast deine Antworten bisher nur in der dir bekannten Welt gesucht und sie nirgends gefunden. Nichts konnte dich von deinem herum irren befreien. Der Grund dafür ist einfach: Du hältst die physische Welt für die einzig wahre Welt. Doch das Physische ist nur eine Erscheinung und du erlebst hier nur Oberflächen. Es gibt keine Hinweise, Pläne oder Karten in der Oberflächenwelt, die dich zu dir führen.

Hier bestellen  bei Amazon

 

Die Antworten auf deine Fragen liegen viel tiefer, außerhalb der physikalischen Welt, jenseits der Oberflächen, im Geheimen und Versteckten. Die Erklärungen der Oberflächenwelt, werden dich nicht zu dir selbst führen. Sie sind dazu gedacht, dich tiefer in das Oberflächensystem zu verstricken, damit du eben nicht auf die Idee kommst, woanders als in der physischen Welt nach dir zu suchen. Mit meinem Buch gebe ich dir die Chance schnell die Oberflächenwelt zu durchdringen und in die Tiefe zu gehen. Tief hinunter zu jenem Wesen, dass du immer schon bist.

Wenn du mehr wissen willst, dann scheu dich nicht das Buch zu lesen oder sieh dich erst auf dieser Website um, lies die Artikel und den Blog - dann entscheide dich.

alles liebe

Joan

Die Ursache ist immer der Geist

 

Ich werde immer wieder  auf verschiedene Methoden und Produkte zur „Aktivierung“ diverser Drüsen, Organe oder Prozesse in uns angesprochen. Die Palette reicht von subliminalen Suggestionstechniken bis hin zur Verwendung psychoaktiver Substanzen oder gar synthetischer Medikamente.

Ich rate strikt von deren Verwendung ab.

Viele  namhafte  Neuro-Wissenschaftler, Physiker und Biologen, Medizinern, Schamanen und Tao- und Qigong Lehrer haben über diese Themen bereits Bücher geschrieben und zum allgemeinen Unverständnis beigetragen. Das Schlimme daran ist, dass sie einiges richtig erkannt, das Messbare katalogisiert und die Abläufe beschrieben haben. Doch niemand hat außer Vermutungen etwas vorzuweisen. 

Die meisten rätseln herum und stellen ihre Vermutungen an, in dem  sie die zu beobachtenden Fakten kombinieren und alle machen den gleichen Fehler.

Dieser Fehler liegt selbstverständlich nicht im jeweiligen Fachgebiet. Nicht in den Messungen und auch nicht in dem, was beobachtet wird. Er liegt nicht darin, dass  die quantenphysikalischen Prozesse  die wunderbaren biologischen Abläufe hervorbringen. All das ist es NICHT. Ich möchte ganz deutlich betonen, dass alle Fachgebiete auf ihrer weltlichen Ebene völlig richtige Ergebnisse liefern.

Jedoch der Versuch diese Ergebnisse auf einer weltlichen Ebene zu einer Ursache zu kombinieren, muss fehlschlagen. Der Versuch ist der Fehler, denn er gründet in einer grundsätzlich falschen Annahme und zwar: Der Geist ist die Folge der Materie. 
Dieses  Axiom ist extrem fest in den schulwissenschaftlichen Disziplinen verankert. Deshalb fällt es den vorprogrammierten Gehirnen so schwer das Offensichtliche zu sehen. Es ist richtig, dass der Geist ohne materielle Erscheinung nicht beobachtbar ist.  Doch daraus abzuleiten, dass er eine Folge seiner Erscheinung ist, ist der fatale Denkfehler. Wenn ein Architekt ein Haus bauen will, dann hat er zuerst eine Idee von diesem Haus. Diese Idee ist nicht materiell, sie ist eine Information. Erst wenn der Architekt anfängt diese Idee in Skizzen und Zeichnungen zu gießen, findet diese Idee ihren Weg in die Materie. Zuerst nur in Form dieser Zeichnungen und Berechnungen, doch dann verbreitet der Architekt seine Idee über die Zeichnungen an die Bauleute und die setzen diese Zeichnungen durch ihre Interpretation in das Gebäude um. Wenn wir jetzt behaupten würden, die Idee des Architekten ist die Folge des Gebäudes folgen wir dem Axiom: Der Geist ist eine Folge der Materie.
Wie absurd das ist, merken wir schon.

Verlassen wir nun das Offensichtliche und machen einen Sprung in das Kleinste und sehen uns zb: die Gehirnchemie an. In unserem Gehirn herrscht eine Atmosphäre extrem schneller elektro-chemischer Veränderungen und extrem langsamer elektrischer Vorgänge. Hormone werden produziert, ausgeschüttet, wieder abgebaut. Je nach dem was wir wahrnehmen oder was von der inneren Körper-Sensorik angefordert wird. Wenn wir diese Atmosphäre analysieren finden wir eine Unmenge unterschiedlicher Moleküle, Hormone, Endorphine, Enzyme usw. die in den verschiedensten Gehirnarealen ihre Arbeit tun. Unsere Analysen jedoch können nur einen kleinen begrenzten Teil der Vorgänge beobachten und so entgeht unserer Beobachtung, die diesen Prozessen übergeordnete zeitliche und organisatorische Struktur. Eine Struktur, die dafür sorgt, dass alle Prozesse in einem sinnvollen Miteinander ablaufen.

Das Erscheinen von Molekülen zB.  Serotonin, Melatonin oder DMT, die in der Zirbeldrüse gebildet werden ist also in die sinnvolle Organisation eingebettet, die dafür sorgt, dass wir nicht am helllichten Tag anfangen zu träumen oder die Realität wechseln. Wir erkennen diese sinnvolle Organisation an ihrer materiellen Manifestation: den Traumphasen und den Wachphasen, den Aktivitäts- und Ruhephasen. Wir erkennen diese Organisation an den auftretenden Molekülen und dem daraus entstehenden Chemo-Cocktail.  Das können wir  beobachten und messen. Wir können auch die geometrische Organisation des Gehirns vermessen und mit bildgebenden Verfahren CT, PET oder MRT  beobachten. Doch was wir messen und sehen ist die Aktivität des Geistes. Der Geist, der wir sind, greift steuernd über das Bewusstsein auf die Materie, die wir Gehirn nennen zu. Dabei spielt das Gehirn nur die Rolle eines „Interface“. Nicht ganz unähnlich dem Aufbau eines Computers, dessen elektronische Komponenten je nach Programmierung in Aktivitäts- oder Ruhezustände verfallen. Nur erkennen wir nicht direkt, dass unsere Natur auf Quantenebene den Spin der Elektronen verändert und sich daraus die atomaren und molekularen Folgen in Form von Hormonen und Enzymen ergeben. Der Geist, der wir sind, übersteigt die Fähigkeiten unserer rationalen, bewusstseinsbasierenden Analysen bei Weitem. Deshalb bietet er uns die vergleichsweise groben Moleküle zur Beobachtung seiner Anwesenheit an.

Erst wenn der Geist, der wir sind, beschließt den Körper schlafen zu legen und zu träumen, beginnt die Verwandlung von Melatonin zu DMT. Die Produktion des DMT in der Zirbeldrüse ist also nicht die Ursache für den Traum, sondern die Manifestation der Absicht des Geistes.  Das Gleiche gilt,  wenn der Geist beschließt  glücklich zu sein: Es erscheinen die Serotonin Moleküle. Selbst dann, wenn wir beschließen die Serotonin Vorstufe 5-HTP  als Kapsel zu uns nehmen, ist diese Tätigkeit ursächlich kausal vom Geist initiiert worden. Der Geist, der wir sind, hat keine Möglichkeit zu verhindern, dass seine Aktivität eine materielle Manifestation hervorbringt. Deshalb und nur deshalb ist es möglich, dass  Gedanken materielle Ereignisse beeinflussen und auf die Neuroplastizität einwirken.

Nehmen wir andere Stoffe zu uns, zB. Medikamente, Nahrungsergänzungsmittel etc. gilt das Gleiche. Der Geist, der wir sind, hat beschlossen dies zu tun und steuert die materielle Realität in der Art, dass wir die Substanzen aufnehmen.  Die Quantenphysiker haben diese Tatsache bereits vor Jahrzehnten gefunden und sind heute auf dem Weg die spirituelle Dimension der Materie zu entdecken. Noch ein Wort zum Geist, der wir sind. Natürlich ist uns die molekulare Manifestation nicht bewusst. Das muss sie auch gar nicht, denn diese unbewussten Mechanismen sind absolut perfekt. Würden wir mit dem uns zur Verfügung stehenden groben „Intellekt“ eingreifen, wäre die Katastrophe perfekt. Unser menschlicher Intellekt, also unserer Erkenntnisfähigkeit und die Fähigkeit Informationen sinnvoll miteinander zu verknüpfen, sind Summenfunktionen, die auf Milliarden von Informationskanälen aufsetzen. Diese Informationskanäle verbinden uns mit dem Nullpunktfeld und den darin gespeicherten Informationen. Wir sind also faktisch direkt mit der Quantenwelt verbunden und leiten aus deren Informationen unser Wissen ab. Genauso erzeugen unsere Gedanken, Erkenntnisse und Erfahrungen Abdrücke im Nullpunktfeld. Diese „Imprints“ beeinflussen die Informationen, die dort bereits vorhanden sind und erzeugen neue Muster, also neue, vorher noch nicht existierende Konstellationen. Alle Informationen stehen dem Geist zur Verfügung und zwar raum- und zeitlos. Wie einflussreich wir also sind, bemerken wir mit unserem Bewusstsein gar nicht. Das Bewusstsein ist ja nur die Software, die wir, Geist, geschaffen haben um die Materie zu formen.

Oft begrenzen wir unser eigenes Denken auf das Wenige, was unser beschränkter Intellekt zur Verfügung stellt und verlieren die Bewusstheit über unsere Macht. Doch wenn wir zurückkehren und das, was wir als Bewusstsein ansehen hinter uns lassen, einkehren in das ursprüngliche Gewahrsein, dann werden wir wissend ohne zu wissen.

 

Zum Schluss möchte ich noch einen Denkanstoß geben: Es gibt den Schmetterlingseffekt, der  sagt: „Der Flügelschlag eines Schmetterlings in Brasilien kann einen Tornado in Texas auslösen“ Bezogen auf unseren Geist und seine Fähigkeiten, erweitere ich es so: „Mein Gedanke verändert dieses und alle von mir für möglich gehaltenen Universen. Er kann Welten erschaffen und zerstören“  Unter diesem Aspekt, sollten wir – jeder für sich selbst – überlegen was er den lieben langen Tag lang so denken und in sein Bewusstsein einlassen will.

Alles liebe

Joan